General Information

  • ID:  hor005243
  • Uniprot ID:  P81027
  • Protein name:  Glucagon-2
  • Gene name:  gcg2
  • Organism:  Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  Produced in the A cells of the islets of Langerhans in response to a drop in blood sugar concentration.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oreochromis (genus), Oreochromini (tribe), Pseudocrenilabrinae (subfamily), African cichlids, Cichlidae (family), Cichliformes (order), Cichlomorphae (superorder), Ovalentaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HAGTYTSDVSSYLQDQAAKEFVSWLKTGRGRRD
  • Length:  33(1-33)
  • Propeptide:  HAGTYTSDVSSYLQDQAAKEFVSWLKTGRGRRD
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  gcgr
  • Target Unid:  I3J0U5
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P81027-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P81027-F1.pdbhor005243_AF2.pdbhor005243_ESM.pdb

Physical Information

Mass: 430201 Formula: C162H249N49O53
Absent amino acids: CIMNP Common amino acids: S
pI: 9.12 Basic residues: 6
Polar residues: 12 Hydrophobic residues: 9
Hydrophobicity: -94.85 Boman Index: -9468
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 50.3
Instability Index: 3948.18 Extinction Coefficient cystines: 8480
Absorbance 280nm: 265

Literature

  • PubMed ID:  7656183
  • Title:  Characterization of the pancreatic hormones from the Brockmann body of the tilapia: implications for islet xenograft studies.